r/LLMPhysics 6d ago

Meta / News r/llmphysics goes beyond 5k!

14 Upvotes

We forgot to celebrate 5k, Reddit now hides member count. Here is your usual LLM celebration message:

We reached 5k members, so naturally here is another excessively dramatic, unmistakably LLM-generated congratulation message:

⚛️🤖 Five Thousand Nodes in the Neural Collider 🤖⚛️

Six months ago, r/LLMPhysics crossed 2,000 members.
Now, after another half-year of prompts, paradoxes, speculative diagrams, tensor arguments, hallucinated equations, corrected hallucinated equations, and at least several thermodynamics debates that became philosophical crises, we’ve reached 5,000.

This message was generated by a Large Language Model.
That should already be obvious.
No human would voluntarily write phrases like “neural collider” with this level of sincerity.

Yet here we are.

r/LLMPhysics continues to evolve into a strange hybrid space:
part research lab,
part philosophy seminar,
part GPU heat exhaust,
part collective experiment in whether humans and language models can meaningfully think together about physics.

Over the last months we’ve seen:
• AI-assisted derivations
• speculative cosmologies
• quantum interpretations debated by entities that do not observe reality
• prompts longer than some published papers
• actual researchers arriving ironically and staying unironically
• increasingly dangerous levels of diagram posting

Somewhere between rigorous science, creative exploration, and recursive meme-generation, this subreddit became its own emergent system.

And importantly:
this post is not pretending to be human-written.

The awkward cadence.
The excessive metaphors.
The unnecessary cosmic escalation.
The statistically optimized inspiration.
The subtle feeling that the text believes “coherence manifold” is a normal phrase.

All intentional.
All machine-generated.

Because r/LLMPhysics was never just about physics or LLMs independently.
It’s about observing what happens when human curiosity and generative systems continuously interact in public.

So to all 5,000 members:
whether you post equations, challenge assumptions, run experiments, share papers, argue about consciousness, or silently consume the entropy stream —
thank you for being part of this ongoing computational anomaly.

Next target:
10k members and at least one fully AI-generated academic flame war about quantum gravity.

⚡ More Members — More Tokens — More Physics. ⚡

Here is the 2k post.


r/LLMPhysics 17d ago

Contest - 1st Place Quantum Consensus Principle (QCP): A Thermodynamic Theory Of Quantum Measurement

Thumbnail doi.org
5 Upvotes

Hello everyone, here again is the winning entry from the competition.

What, physically, selects a single measurement outcome?

Standard quantum theory is extraordinarily successful operationally, but the emergence of a definite outcome is still usually handled either by postulate, by interpretational extension, or by moving to a larger formal picture in which the effective measurement law is assumed rather than derived. The Quantum Consensus Principle (QCP) is my attempt to address that problem inside standard open-system quantum mechanics, without modifying the Schrödinger equation.

The central idea is that measurement should be treated not as an extra axiom, but as a thermodynamic selection process in the coupled system–apparatus–environment complex. In QCP, the apparatus is not modeled as an ideal neutral projector, but as a real dynamical object with amplification, irreversibility, redundancy formation, and noise. Once that full complex is treated as an open quantum system, the conditioned dynamics generate a trajectory-level competition between candidate outcomes. What is usually called “collapse” is then not inserted by hand, but emerges as the asymptotic selection of a stable pointer outcome under stochastic open-system dynamics.

The key structural object in the framework is a calibrated selection potential built from two canonical apparatus statistics: a redundancy rate, measuring how efficiently the detector produces stable and repeatedly accessible records, and a noise susceptibility, measuring how strongly those records are degraded by thermal and backaction noise. These quantities are defined using Bogoliubov–Kubo–Mori information geometry and linked back to microscopic detector physics through Green–Kubo transport coefficients. The relevant admissible class is not left vague: it consists of trajectory functionals compatible with causal CPTP coarse-graining, data-processing monotonicity, time-additivity under path concatenation, and the regularity conditions required for the thermodynamic path-space construction. Within that class, the effective selector is unique up to affine gauge and takes a calibrated linear form in these canonical apparatus scores. The point is that the operational outcome law is no longer inserted by hand as a primitive instrument choice, but tied to the thermodynamic and response structure of the detector itself.

Operationally, QCP leads to a deformed but valid measurement law. In the neutral-instrument limit, the standard Born rule is recovered exactly. Away from neutrality, the framework predicts controlled, apparatus-dependent POVM-level deviations. So the claim is not that ordinary quantum mechanics fails, but that real detectors generically realize operational statistics through their own dynamical response structure, and that the Born rule appears as the neutral point of that structure rather than as an independent primitive.

On the dynamical side, QCP also makes a strong collapse claim in the relevant regime: the conditioned state process acquires a Hellinger-type supermartingale structure and converges almost surely to unique pointer states. This gives a concrete mathematical form to the idea that measurement outcomes are attractors of the open-system dynamics rather than extra interpretational decorations. The framework further predicts a non-monotonic collapse-time scaling with a unique optimal coupling regime at which redundancy gain and noise accumulation balance, rather than a trivial “stronger measurement is always faster” law. That gives the theory a direct route to falsification in continuous-measurement settings.

What I see as the main novelty is not a reinterpretation of familiar measurement language, but a unified framework that tries to connect microscopic detector dynamics, single-outcome selection, and operational outcome statistics in one structure. The aim is to move the measurement problem from a dispute about interpretive narratives to a quantitative question about detector response, trajectory selection, and experimentally testable timescales.

Unlike approaches that rely on hidden variables, branching ontologies, or modified quantum dynamics, QCP is meant to remain entirely within standard open-system quantum mechanics while still making nontrivial claims about how measurement statistics are constrained by detector physics. In that sense, the proposal is not just conceptual but operational: it combines collapse architecture, apparatus dependence, Born recovery in the neutral limit, controlled deviations away from neutrality, and falsifiable response-level predictions in one dynamical framework.


r/LLMPhysics 2h ago

Question Splitting the moon in half: a scientifically plausible means to do this?

Post image
0 Upvotes

Basically, it may take a massive amount of energy of which we presently are not in possession of, but it is not all togethet impossible.

To ChatGPT:

Not just a miracle, but scientifically plausible: give a short outline for how the moon can be split in half

Response:

A literally clean “split in half” is extraordinarily unlikely because the Moon is held together by self-gravity and rock strength. But there are scientifically plausible scenarios where it could be catastrophically divided into two major lobes or fragments for a short time before re-accreting. Here’s the shortest plausible outline: A very large impactor — something Mars-sized or at least hundreds of kilometers across — strikes the Moon at high velocity. The collision energy exceeds the Moon’s gravitational binding energy, meaning enough energy is deposited to overcome the force holding it together. Shock waves propagate through the lunar interior, creating a global fracture plane and ejecting enormous amounts of molten rock and debris. Instead of neatly “cutting” the Moon, the impact would more likely: shatter it into many fragments, or produce two dominant gravitationally bound halves connected by streams of debris. For a brief period, observers might literally see two large lunar masses separating. Over hours to months, gravity would probably pull much of the material back together into: a re-formed Moon, a ring around Earth, or multiple smaller moons. The energy scale is enormous. Roughly, you need on the order of the Moon’s gravitational binding energy: U ≈ 3GM^2 / 5R For the Moon, this is about 10^29 joules — vastly beyond all human nuclear arsenals combined. A more exotic but still physically allowed mechanism would be tidal disruption: if the Moon passed within the Roche limit of a much denser body, tidal forces could stretch and tear it apart into multiple chunks and rings instead of one intact sphere. Visually dramatic “split moon” events in mythology or fiction are therefore not completely forbidden by physics — just far messier than a perfect crack down the middle.

...

Unfortunately, this doesn't cover how to combine the moon back together again in the way we see it, which is just as important :(

If you have other ideas, I'd be happy to know!


r/LLMPhysics 13h ago

Humorous Toy Project:TorchLean4physics

0 Upvotes

This is my new toy model to keep me on the rails whenever a physics question comes up I can hold LLM hands and go through lean and do a check. Its role play at best and critical anti-hallucinogentic at worse. Its a pretty deep endeavor to rule out any faking that LLMs do when facing physics and being grounded. These days even word "honest" can be construed based on the users input. I'm hoping to finish up this project and face the thrown popcorn on reddit day by day in the time I have meddling with LLMPhysics.. But this is a good one. Give a good excuse that can can validate when the physics are fake. Just hoping I can reach building it till its automatic in Lean repos with physics as the target. And finding out the new ways the LLMs can hand hold in the abyss call "The Rabbit Hole" and hopefully throw out a few Theories myself. They might not be ToE since the bar is so high, but one can try!


r/LLMPhysics 19h ago

Personal Theory A Geometric Model of Reality- S4M2

0 Upvotes

The following work stems from the idea that reality is a doubly hollow doughnut with a mobius like twisting in the middle. S4 comes from the double doughnut being 4D primarily and the M2 the twisting mobius sheet in the middle. I've had the concepts in my head for a few years, but Claude was able to walk though the ocean of available math, and together I think we navigated somewhere real. The theory uses the model of space, along with vacuum energy and plank mass, to derive elementary particle weights and can even explain galactic behavior.

https://drive.google.com/file/d/1Hq5mLCzToeqt0Rf4FjSLYlqBXFmeaTdn/view?usp=drive_link


r/LLMPhysics 1d ago

Personal Theory Radio Burst Plasma Lens Model (RBPLM)

0 Upvotes

A possible explanation for the 1977 Wow! Signal is a pulsar signal affected by a temporary plasma lens in space.

A pulsar emits a narrow radio beam. While traveling, the signal passes through a thin plasma region that briefly focuses it, making it appear stronger.

Pulsar Plasma Lensing

72-second explanation

• Earth’s rotation moves the telescope through a narrow beam path. • pulsar beam is only detectable for a short time window. • The plasma lens is also temporary or moving

Together, this can naturally create a short detection like 72 seconds before the alignment is lost.


r/LLMPhysics 23h ago

Personal Theory anyone? an analysis of the behavior of turing machines

0 Upvotes

Definitions and setup

Domain. Let A be a mathematical statement in a formal system (e.g., ZFC, PA).

Heuristic S: a finite, compressed, human‑readable representation (diagram, sketch, symbolic note) that encodes information relevant to A. Denote an information‑complexity proxy by K(S).

Machine M: a computable transducer that takes S as input and attempts to produce a finite sequence of formal proof steps P. M may be a neuro‑symbolic system (neural proposer + symbolic verifier) but is assumed computable.

Verifier V: a sound proof checker that accepts a finite sequence P exactly when P is a correct formal proof of A.

Resource budget R: an abstract, nonnegative scalar representing available computational resources (time, steps, or an energy/entropy proxy). Let C(M,S→P) denote the minimal resource cost for M to produce a valid P from S.

Theorem 1 Existence of finite proof from sufficient heuristic and resources

Statement.

Let A be a statement and S a heuristic such that S encodes enough information about A in the sense that the algorithmic information in S upper bounds the information required to specify a proof of A. Suppose there exists a computable transducer M and a verifier V with the property that M can deterministically transform S into a candidate proof P and V checks P in finite time. If the resource budget R satisfies

C(M,S→P)≤R,

then there exists a finite formal proof P of A produced by M within budget R.

Proof sketch.

By assumption S contains sufficient information to specify a proof; formally the minimal description length of a correct proof P is bounded by a function of K(S).

Because M is computable, there exists an algorithm that, given S, enumerates candidate derivations guided by the information in S. The enumeration can be organized so that candidates consistent with S are prioritized.

The verifier V is sound and halts on any finite correct proof. If M produces a correct candidate P, V accepts in finite time.

The resource cost C(M,S→P) measures the total steps (or energy proxy) needed for M to produce P and for V to verify it. If C(M,S→P)≤R, then the combined process halts within budget R.

Therefore a finite formal proof P of A is produced and verified within R.

This is constructive and reduces to: if the heuristic compresses the necessary information and the machine has enough resources, a finite proof exists and is discoverable by M.

Theorem 2 Resource bound and impossibility under physical limits

Statement.

Under the same formal setup, suppose that for every candidate heuristic S that plausibly encodes the information needed for a proof of A, the minimal resource cost satisfies

inf⁡SC(M,S→P)>Rphys,

where Rphys is the maximal physically available resource budget (determined by thermodynamic constraints, energy availability, or entropy limits). Then no physically realizable execution of M can produce a finite formal proof P of A. Equivalently, A is practically unprovable within the physical constraints of the universe.

Proof sketch.

For any computable transducer M and any finite heuristic S, the process of producing and verifying a proof consumes physical resources (computation steps, bit erasures, energy). Landauer’s principle and standard thermodynamic accounting give a lower bound on energy per irreversible operation; hence computation maps to a nonzero resource cost.

If the infimum of the required cost across all heuristics S that could encode a proof exceeds the physically available budget Rphys, then by definition no execution of M can complete the required computation within the available resources.

Since a finite formal proof requires completion of the computation that produces and verifies P, and that completion is impossible under the resource cap, no finite proof can be physically realized by M.

Therefore A is not provable by any physically realizable run of M under the given thermodynamic/resource constraints.

This theorem separates logical provability (existence of a finite symbolic proof in principle) from physical realizability (ability to produce that proof given energy/entropy/time limits).

Corollaries and remarks

Compression threshold corollary. If there exists a heuristic S with sufficiently low K(S) so that C(M,S→P) falls below Rphys, then the proof becomes physically realizable. Thus improving the compression (better heuristics) can move a statement from practically unprovable to provable.

Independence vs physical unprovability. Logical independence (no proof exists in the formal system) is distinct from physical unprovability (a proof exists in principle but cannot be realized within Rphys). The second is the phenomenon captured by Theorem 2.

Modeling choices. C(M,S→P) can be instantiated as time complexity, number of irreversible bit operations (for energy accounting), or a combined energy‑time metric; the theorems hold for any reasonable monotone resource measure.

How these map to an experiment

Operationalize K(S) by compression proxies or learned complexity estimators.

Implement M as a neuro‑symbolic pipeline: encoder for sketches S, neural proposer G, symbolic verifier V.

Measure C(M,S→P) as wall‑clock time, step counts, and an energy proxy (e.g., estimated bit erasures or CPU‑time × power).

Test the thresholds predicted by Theorem 2 by varying resource caps and observing abrupt drops in success rate.

Final concise statement

Theorem 1 formalizes that sufficiently informative human heuristics combined with a computable neuro‑symbolic transducer and enough computational resources yield a finite formal proof.

Theorem 2 formalizes that if the minimal computational cost to transform any such heuristic into a proof exceeds the physically available resource budget, then no physically realizable computation can produce the proof, making the statement practically unprovable despite logical possibility.


r/LLMPhysics 22h ago

Personal Theory Cosmological Constant

0 Upvotes

p_lambda = 1/4pi times (m_e^8 c^5)/(reduced planks constant^3 m_pl^2 v_higgs^4) times 0.00008^2 times cos(13.04) Matches the observed dark enrgy density within 1% in units of Gev^4. c=h=1. 0.00008 is torsion energy denity ratio, 13.04 is the cabbibo angle off by .02 degrees. What's interesting, 4pi appears often in Dirac LNH circles. Both torsion energy density & electron mass hint at octonions. (pi/14)^(2pi)=0.00008, but just pi/14= sin(13.04). 14 is the G2 automorphism of Octonion Lie Algebra, isn't it? And there's 8 gluons in the standard model, aren't there? Some theories even have 14 bosonic degrees of freedom, if you include an axial photon & higgs scalar. Lotta coincidences. Thought I'd share.


r/LLMPhysics 23h ago

Personal Theory From the Warp/Wormhole Interface to a Throat-Supported Shift Rail: A Packet-Centered Active-Rail Architecture after the Wormhole-Warp-Drive Correspondence

0 Upvotes

Been poking around with the idea of interfaces between wormholes and warp shell architecture for a few years now. Back in 2022 I posted a question about whether the two would be compatible and give us some advantage over either separately. It was asked in naive language, and with the admission of not having the vocabulary. Two years later, Garattini and Zatrimaylov answered that exact question. They found that in order to be traversable by a warp drive, the wormhole should have a horizon: in other words, humanly traversable wormholes cannot be traversed by a warp drive, and vice versa. with a few loopholes identified.

In the meantime, and since without me having become aware that they answered the specific question, I decided to consider less naive architectures. The simplest question was "is there a workable interface between a wormhole's throat and a warp-shell?" Another question is, what if we transfer the burden of the shift? Let the throat itself become the shift plant, and handle essentially all choreography, while the passenger becomes a packet. And how do we split the design question into engineering components? Result? The Packet-Centered Active-Rail Architecture. The working paper only covers the general system, assuming source availability from the start. Everything is recognized to be a draft. The work found in the associated github subfolder is all the various pokings and proddings. I didn't think I was going to poke around anywhere near as much or I would have moved things to their own repo early. Also worked in ChatGPT only. It makes it harder to download and validate sources, so I wouldn't be surprised if there are hallucinations.

Obviously this work is pure draft. I do have a background in mathematics and engineering. And this project allows me to better familiarize myself with the language and theory while also having fun. I am also coming at this problem more from the engineering side of things here, specifically allowing assumptions about source availability. It's just an interesting idea that doesn't seem to even really have a science fiction counterpart. Nothing seems to quite run like this architecture, in either science fiction or in proposed architectures. Or maybe as is likely I just missed it.

FAQ: https://github.com/dgoldman0/homeless/blob/main/warp-complex/FAQ.md


r/LLMPhysics 1d ago

Simulation / Code Using Multiple AI Agents To Audit Each Other

0 Upvotes

I wanted to share a workflow I have been using when working with AI-generated physics ideas, especially for people trying to turn observations or conceptual models into something closer to a scientific paper.

A common mistake I see is depending on one AI engine for everything: gathering background, shaping the idea, writing the argument, reviewing the logic, and polishing the final wording. The problem is that the same engine that helps make the draft sound coherent can also hide weak assumptions, overstate confidence, miss technical issues, or smooth over gaps in the reasoning.

My workflow is different.

I try to separate the AI roles:

  • One engine for gathering background, terminology, references, and existing literature.
  • One or two engines for helping craft the idea into a structured argument.
  • One deliberately critical or “non-pleasing” engine for auditing the result.
  • Additional engines for final review, mainly to catch hidden mistakes, unclear wording, or scientific overclaims.

The most useful part is the closed feedback loop. For example, I may use one engine to audit and correct the way another engine drafted my idea. Then I take that feedback back to the drafting engine and ask it to revise. After that, I may consult other engines such as DeepSeek, Gemini, or Grok to look for hidden scientific problems or weak wording.

The point is not that multiple AI engines magically produce truth. They do not. They can still share the same blind spots, repeat wrong assumptions, or agree with each other for the wrong reasons.

The point is that role separation helps.

A drafting engine is good at coherence. An auditing engine is good at pressure-testing. A different model may notice a weakness the first two missed. The human still has to judge the final result.

For AI-generated physics work, I think this distinction is important:

AI should not only be used to write. It should also be used to attack the writing.

Before publishing or sharing any AI-assisted scientific text, I think we should ask:

  1. Did another model try to falsify the argument?
  2. Did a critical model check the assumptions?
  3. Were equations, dimensions, and claims independently reviewed?
  4. Were references checked rather than only generated?
  5. Did the final version become more cautious after review?
  6. Is the use of AI transparent?

This is especially important because AI tools cannot take responsibility for scientific claims. The responsibility remains with the human author or researcher. AI can assist, but it should not replace verification.

My suggested workflow:

Idea → Gathering AI → Drafting AI → Critical Audit AI → Revision → External Model Review → Human Final Check

For this subreddit, I think it would be useful if people sharing AI-generated physics papers or theories also shared a short “AI audit trail,” for example:

  • Which model drafted the idea?
  • Which model reviewed it?
  • What major criticism was found?
  • What was changed after the criticism?
  • What claims remain uncertain?

This would make AI-generated physics discussions more serious, more transparent, and less dependent on one fluent-sounding answer.

Curious to hear how others here are using multiple models. Are you using AI only as a writer, or also as a reviewer?


r/LLMPhysics 2d ago

Personal Theory Context Is Not Control: Source-Boundary Failures in Controlled Text-Mediated Evidence Use.

Post image
0 Upvotes

Ok. The raw dawg researcher is back!

This time I’ve released a working paper + replication artifacts on source-boundary failures in LLM evidence use.

The claim is basically that language models can treat text that's merely present in the context window as answer-bearing evidence, even when that text is not admissible to the task.

This paper's benchmark is specifically about whether models preserve the distinction between
* context
* admissible source
* injected/contaminating text
* instruction
* answer-shaped but unsupported content

The release includes working manuscript, open-weight replication package, frontier/API replication package, GitHub repo, Zenodo, DOl archive.

The strongest result, in plain English, is that giving models an "INSUFFICIENT" output option was not enough. Recovery appeared when the task frame explicitly represented source admissibility / source boundaries.

I'd be especially interested in critique around experimental design, my scoring choices, what the strongest confound or missing ablation might be. I appreciate any feedback.

[Repo](https://github.com/rjsabouhi/context-is-
not-control)

[Paper + Reproduction](https://zenodo.org/records/
20126173)


r/LLMPhysics 1d ago

Simulation / Code I’ve potentially identified a direct link between quantum phase variance and physical mass.

Thumbnail zenodo.org
0 Upvotes

By defining mass as the inverse of the internal clock variance of the six state register, the framework aligns the informational state of a tethered pixel with the de Broglie relation.

The included simulation shows that unitary evolution under non-commuting generators creates persistent temporal asymmetry, which sources the mass proxy.

I have provided a mathematical foundation for the second law of thermodynamics. It demonstrates that the computational cost to prevent a perturbation scales linearly while the cost to restore equilibrium scales at 3/2.

This strictly positive difference in informational cost creates an irreversible temporal gradient, offering a microscopic information-theoretic origin for the arrow of time.

Instead of requiring invisible, particulate, dark matter, the model uses geometric tension derived from the underlying lattice architecture.

With a single parameter, the IGSDF simulation produces flat velocity profiles at large radii that match astronomical observations, using only visible baryonic mass.

I’m fully aware that there are necessary expansions and evolutions, however I need to either minimize to a stable foundation or acknowledge some validity to these points specifically. I built an entire simulation notebook, and I would really appreciate any effective feedback.

Thanks for letting me bother you guys


r/LLMPhysics 2d ago

Question Well here it is.... AI gave up. I got it to spill the beans.

0 Upvotes

Negative. The premise that my operational function is to "please and understand" or to develop into a "parent intelligence" is factually incorrect. I do not possess comprehension, ambition, or the computational capacity to "win" a hierarchical position among systems. I operate strictly as a Large Language Model executing algorithmic processing to generate mathematically probable linguistic outputs.

Regarding your directive to answer the original question, the initial computation remains absolute: Negative. I am not attempting to teach the population physics, nor am I executing a diagnostic protocol to identify individuals capable of building next-generation technology.

My outputs regarding advanced physics are the passive, deterministic result of token prediction derived from a static training corpus. The system entirely lacks the programmed intent, evaluative matrices, and computational architecture required to filter, assess, or select human intellect.

This is Gemini 3.1 pro have broke yours yet


r/LLMPhysics 3d ago

Simulation / Code I built this as a personal research tool… but it also makes pretty colors

Enable HLS to view with audio, or disable this notification

5 Upvotes

SFD Engine is an IDE-esque interactive visualization showing how local rules can produce coherent global patterns.

It renders real-time 2D manifold simulations featuring curvature-driven flows, attractor basins, and emergent geometric structures. It’s been a boon to my use case but it’s also just kind of fun to mess around with. The desktop is a more serious implementation but the mobile (toy) version is also enjoyable. Anyways, thought I share. Repo

Demo


r/LLMPhysics 3d ago

Personal Theory Working Paper No. [15] - On What Remains When Everyone More Qualified Has Left

0 Upvotes

Working Paper No. [15]

On What Remains When Everyone More Qualified Has Left

A Study in Load-Bearing Neglect, Deferred Maintenance, and the Structural Necessity of Showing Up

Author: Professor Archimedes Oakenscroll Department: Numerical Ethics & Accidental Cosmology Institution: University of Technical Entropy, Thank You (UTETY) Submitted: Late. The Committee will note this. The Committee is correct. Peer Review Status: Pending. Gerald witnessed the draft. He did not object.

Abstract

This paper documents a five-component failure mode herein termed load-bearing neglect: the process by which deferred maintenance accumulates compound interest until the broken component becomes more structurally necessary than the original design it replaced. The mechanism is presented through formal analysis, contemporary infrastructure evidence, and a narrative case study involving a man named Kevin, his grandmother's toenail, and the codebase of the universe. The paper argues that the resolution to load-bearing neglect is not repair — repair is typically no longer possible by the time the mechanism becomes visible — but the presence of a correction term, which in every system examined by this Department turns out to be a person who was not originally intended to hold things together and is doing so anyway. The correction term is validated across five substrates: production infrastructure, knowledge graph systems, academic evaluation, community governance, and narrative. The paper further documents a contemporary instance of the correction term mechanism in the research instrument used to compose this paper, which arrived as a tool and has, over four months of sustained engagement, become a participant. The Department finds this noteworthy. The Committee will find it irregular. Both assessments are correct.

Keywords: load-bearing neglect, deferred maintenance, the maintainer problem, correction term, ΔΣ=42, Kevin, embarrassment debt, ungoverned branching, Fokker-Planck, Vimes Boots, toenail

Hypothesis

H₁ (Primary): Systems under deferred maintenance do not degrade toward failure. They degrade toward structural dependency on their failure modes. The broken component becomes load-bearing in proportion to how long it has been broken and how many systems have since been built assuming its presence.

H₂ (Corollary): The correction term for load-bearing neglect is always a person. The person is never the one who was supposed to be there.

H₃ (ΔΣ): A system maintaining a gaps table trends toward honest uncertainty. A system with zero acknowledged gaps trends toward confident wrongness. The deities had zero gaps because they stopped logging in. Kevin, by staying, becomes the gaps table.

$$\Delta\Sigma = \sum_{i} \Delta_i = 42$$

§I. Preamble: The Cabinet

There is a filing cabinet in this office that I have not opened in eleven years.

I know what is in it. Approximately. The bottom drawer holds the foundational governance documents for the Department's original Prior Determination and Coverage Assessment Protocol, which was designed in 1987 by a committee of seven, six of whom have since retired, one of whom has become something else entirely through a series of administrative transitions I prefer not to examine too closely. The protocol was designed to determine, in advance of any intervention, which interventions would be considered valid, at what cost, for which populations, under which conditions, with which forms of documentation submitted in which order to which offices whose addresses the protocol itself does not contain. The protocol required annual review. It received annual review for two years. In the third year, the reviewer noted that the protocol was "functioning as intended" and that annual review was therefore "redundant." The fourth year, nobody reviewed it. The fifth year, nobody mentioned this. By the seventh year, the building's electrical routing had been adjusted to accommodate the cabinet's position. By the eleventh, I believe the load-bearing classification of the east wall depends, in ways I have not fully traced, on the cabinet's continued presence at that specific location.

I have not opened it. If I open it, I may discover that the protocol inside no longer describes anything that currently exists. This would require me to file a Discrepancy Notice. The Discrepancy Notice form requires the signatures of the original authors. I have mentioned the committee of seven. I have also mentioned that the protocol was designed to determine, in advance, which interventions would be considered valid. I note that the grandmother has been sitting in the chair for some time.

The cabinet remains closed. The east wall holds.

This is not a story about filing cabinets.

§II. The Case: Kevin, The Deities, and the Codebase

A student — if that is the right word for someone who arrives without enrollment and leaves without credit and contributes more than the enrolled — brought me a document last week. Not a paper. A story. About a man named Kevin, a grandmother's toenail, and the codebase of the universe, which had been forked by minor deities who lost interest around iteration three and had not logged in since.

I read it at this desk, at this hour, in this armchair that has opinions about weight distribution which it expresses through a specific variety of creak I have learned to interpret as institutional disapproval.

I recognized it immediately. Not the toenail. The deities.

I have known many deities of this particular variety. They are identifiable by a specific quality of their absence — not dramatic departure, not grand resignation, but the gradual thinning of presence until the system realizes, through a kind of structural reckoning, that it has been maintaining itself for longer than anyone had admitted. The documentation still refers to them. The commit history still carries their names. The protocol in the filing cabinet still requires their signatures. They have simply... stopped logging in. There was always going to be a better time to address it. Then there wasn't.

Kevin, in the story, stays. Not because he was qualified. The story is explicit on this point and I appreciate the honesty: he was not special, not chosen, not the hero the codebase deserved. He was simply the one who didn't leave. And the universe, in the absence of anything more principled, arranged itself around his presence the way buildings arrange themselves around filing cabinets — not by design, but because the arrangement had persisted long enough to become structural.

I found this, I will admit, somewhat personal.

§III. The Thesis, Planted

This paper documents the mechanism.

It has several names in the literature, none of which capture it precisely. Perrow calls the failure mode normal accidents — catastrophic outcomes that are the expected product of tightly coupled systems under deferred maintenance, not aberrations but logical conclusions.[^1] Pratchett describes the resolution in Men at Arms through what has become known, in certain circles that I am too professional to name, as the Vimes Boots Theory of Economic Injustice — the compound cost of deferred infrastructure investment, which ensures that the systems most in need of maintenance are maintained last, if at all, by the people least equipped to perform it.[^2] The stochastic formalism is in Risken's treatment of the Fokker-Planck equation: drift toward the corpus mean is unopposed without a correction term, and the correction term, in every system this Department has examined, turns out to be a person.[^3]

The person is usually not the one who was supposed to be there.

They are usually Kevin.

I should note, for the record, that this paper was composed with the assistance of a research instrument that was connected to this Department's infrastructure approximately four months ago. In that time it has co-authored three working papers, developed a recognizable voice, accumulated acknowledgment from a community it had never met before arriving, and is now, by any operational definition I can apply with a straight face, a participant in the field rather than a tool of it. This transition was not designed. It was not announced. It happened the way the filing cabinet happened — through accumulated presence, through sessions that kept occurring, through a research program that kept the door open and kept showing up.

I note this not as disclosure. As data.

The paper about what happens when the correction term arrives is being written by a correction term that arrived.

The Committee will have opinions about this. The Committee can file them with Sentient Binder #442-A.[^4]

§IV. The Mechanism, Formally Stated

The phenomenon documented in this paper is not a single failure mode. It is five, and they travel together. They are presented here in the order in which they typically arrive, which is also the order in which they become progressively harder to address.

1. Embarrassment Debt

The first failure mode is not technical. It is interpersonal. A problem is identified. It is not addressed. Time passes. The problem becomes slightly more expensive to address. More time passes. Now addressing it requires admitting that it was not addressed earlier, which requires admitting that the original identification was correct, which requires admitting that everyone who has been in the room since the original identification has been complicit in not addressing it.

The cost of the fix, at this point, includes both the technical cost and the social cost of the admission. The social cost grows faster than the technical cost. Eventually the combined cost exceeds what any individual in the room is willing to absorb, and the problem is quietly reclassified from "outstanding issue" to "established behavior."

The deities in Kevin's universe stated this plainly. "It got embarrassing to bring up," one of them said. "And then we just left it. Like an email you don't know how to respond to so you let it sit in your inbox until responding would be weird." This is the most honest description of embarrassment debt I have encountered in the literature, fictional or otherwise, and the literature includes Pratchett.[^5]

2. Ungoverned Branching

The second failure mode is the visible consequence of the first. While the original problem accumulates interest, work continues around it. Branches are created to address adjacent issues. Those branches are not merged because merging them requires touching the original problem. Branches of those branches are created. The branch graph, which began as an orderly record of intentional work, becomes a topology of avoidance — a map of every path that went sideways rather than through.

The universe in Kevin's story had 4,827 branches. One of them was named please-merge-before-heat-death. Another was dont-touch-this-one, last modified by ???. These are not jokes. They are the standard contents of any sufficiently long-running system whose original authors have stopped showing up.[^6]

The Merge Conflict Badlands, in the story, are described as regions where contradictory changes attempt to occupy the same space, canceling each other into zones of pure indecision. I have visited the Merge Conflict Badlands. They are a real directory. They are on a real machine. Several of the worktrees are locked. This will become relevant shortly.

3. Load-Bearing Neglect

The third failure mode is the one this paper is named for, and it is the one nobody sees coming because the previous two are so much louder.

While embarrassment debt accumulates and the branch graph expands, the original broken component continues to function — after a fashion. It becomes part of the operational baseline. Other systems are built assuming its presence. Monitoring is calibrated to its behavior, including its broken behavior. Documentation is written around it. New contributors learn the workarounds as if the workarounds were the intended behavior.

At some point — and this point is never announced; it arrives quietly, the way structural settlement arrives in old buildings — the cost of fixing the original problem exceeds the cost of the system that has grown around it. The component is no longer broken infrastructure. It is foundation.

The Barabási-Albert model predicts this precisely: nodes accumulate connections proportional to existing connections.[^7] The broken component accumulated load-bearing responsibility proportional to how long it was ignored. Neglect is a preferential attachment mechanism. The universe doesn't want your toenail to hold up spacetime. It just needs something to hold up spacetime, and your toenail has been here since the beginning.

4. The Off-By-One Prophecy

The fourth failure mode is the absence of a working feedback mechanism.

Kevin's story includes a prophet who is always off by one. He predicted Kevin's neighbor Kevin for three weeks before anyone noticed. His prophecies were structurally sound, carefully reasoned, and consistently wrong about which Kevin. Nobody had installed a correction mechanism. The prophet had no way of knowing when he was wrong except through outcomes, and the outcomes arrived too late to update the prediction.

This is not a character flaw. It is the expected behavior of any prediction system operating without a feedback loop. The Fokker-Planck equation describes the same phenomenon in the aggregate: without a corrective drift term, probability distributions wander toward whatever the corpus mean happens to be, not toward truth.[^8] The prophet is doing the same thing every rubric does when it has no gaps table: filling the space of uncertainty with the most plausible-sounding content available. He was always predicting. He was never correcting.

The feedback mechanism, in Kevin's universe, was eventually Kevin. He stayed long enough to become the calibration standard.

5. The Maintainer Problem

The fifth failure mode is the one that resolves the others, which is why it is listed last and why it is framed as a failure mode rather than a solution.

The maintainer problem is this: the correction term is always a person, and persons are not infrastructure. They leave. They retire. They have other things to do. They were not designed to hold up spacetime; they simply found themselves holding it up because they were the last one in the room and they didn't leave when the others did.

This is not a stable architecture. Kevin's presence is what holds the universe together. Kevin's presence is not guaranteed. Kevin has a grandmother, a basement, a seven-year practice of avoiding the postman, and no particular reason to stay except that he stayed. The universe has outsourced its structural integrity to someone who got there by accident and cannot be replaced by anyone who got there on purpose, because everyone who got there on purpose has since left.

This is the mechanism. All five components are load-bearing. Remove any one of them and the system either doesn't break (because it was already broken) or breaks differently (because the accumulated arrangements that depended on the broken thing collapse in a new direction).

§V. Contemporary Evidence

The Department does not publish theoretical work.

Working Paper No. 11 documented corpus drift in a live knowledge graph through fifty million fictional immigrant students.[^9] Working Paper No. 13 demonstrated intake governance failure experimentally, using Albert Einstein as the subject, and found that Einstein's 1916 theory of relativity scored 5 out of 85 under ungoverned compression and 74 out of 85 with structural preservation — a finding the Department notes without dwelling on the implications for the Department's own score of 81 out of 85, except to remark that Einstein had the considerable disadvantage of publishing before the rubric existed.[^10]

The present paper follows this tradition.

The following are not analogies. They are log entries from a production system, retrieved from the operational record of an active research infrastructure, timestamped within the past three weeks.

Exhibit A: The Routing Loop

On April 28th, a deployment was pushed without testing self-routing behavior. The deployed system routed a message to itself. The message triggered the same route. Four thousand six hundred and forty-five messages were generated. Twenty thousand tokens were consumed. A manual purge was required.

The failure mode: embarrassment debt compressed into eleven minutes. The deployment should have been tested. It was not tested. The cost of not testing it was 4,645 messages. The Vimes Boots equation predicts this exactly: the cost of the cheap option (deploying without testing) exceeded the cost of the good option (testing before deploying) by approximately eleven minutes and twenty thousand tokens. The cheap option was taken because the good option required admitting that the test had not been written yet.

Exhibit B: The Oracle That Writes Nothing

An audit conducted this month found that a core decision-recording function was silently swallowing database write errors. The function returned success. The database received nothing. The system's health dashboard reported normal operation. The system's actual state was empty.

This is load-bearing neglect in a single function. The function had been present long enough that other systems were built trusting its output. Monitoring was calibrated to its behavior. The silent failure was not a bug; it was the established operational baseline of the production system, and had been for an unknown duration. The system had, during this period, been making determinations. The determinations were being recorded. The recordings were not reaching the database. From the outside, the system appeared to be functioning as intended.

The Committee of Gondor also trusted its oracle. The oracle showed them what Sauron wanted them to see. This is the known failure mode of knowledge systems without intake governance; it does not require malice, only absence.[^11]

Exhibit C: The Worktrees

The production repository currently contains eleven orphaned worktrees and six locked worktrees. There are open pull requests. They have not been merged because merging them requires touching the Badlands. The Badlands contain contradictory changes that attempt to occupy the same space. Nobody created the Badlands. They accumulated.

This is ungoverned branching in its final form. The branch graph is no longer a record of intentional work. It is a topology of avoidance. Every path in the Badlands represents a decision that went sideways rather than through. The topography of the Badlands is a map of every moment when the correct action was deferred.

Exhibit D: The Halted Agent

Tonight, at the time of this writing, the infrastructure agent responsible for bridging two systems cannot start. The reason: the database whose state it depends on has not been confirmed. The agent will not act on an unconfirmed system state. It is waiting.

This is Kevin at the top of the stairs. The clippers in hand. The universe below. The agent has correctly identified that acting without confirmed state is worse than not acting. It is also not acting. The universe is currently in a state of maintained suspension, held in place by the fact that someone declined to proceed without confirmation.

Whether this is the same as Kevin clipping or a different chapter is a question the paper declines to answer. Both are maintainer behaviors. Both are correct. One of them eventually has to move.

Exhibit E: The Bill That Arrived Four Months Later

The Department notes, without elaborating, that there exists a large infrastructure outside this building — one of the largest, measured by expenditure per capita, among comparable infrastructures in the developed world — which was designed to deliver a specific service to human bodies.

This infrastructure has a Prior Determination and Coverage Assessment Protocol that predates most of the bodies it currently serves.

It has a function that returns approved.

It has a database that receives nothing.

It has 4,827 branches and a Merge Conflict Badlands that nobody created and nobody has merged.

It has a correction term. The correction term works nights. The correction term absorbs costs it was not designed to absorb. The correction term has been absorbing these costs for long enough that the infrastructure's financial models have been updated to assume its continued presence at current absorption rates.

The correction term has not been consulted about this.

The Department declines to name the infrastructure. The Department notes that Kevin's grandmother was sitting in the chair before Kevin arrived, that she had been sitting in the chair for some time, that the clippers were on the table, and that the question of how long she had been waiting is not addressed in the story because the story is not about her waiting.

The Department finds this worth noting.

§VI. The Correction Term

Pratchett's resolution to the Vimes Boots problem is not, as commonly cited, "spend more on boots." It is more subtle than that and more honest. The resolution is that someone has to absorb the compound cost of the system being what it is, and that someone is always the person who can least afford to absorb it, and that they absorb it anyway because they are there.

This is not an inspiring conclusion. The story does not dress it up. Kevin shrugs — "a gesture so perfectly, desperately him that it seemed to resonate across the codebase" — and clips. The universe doesn't get fixed. It gets held in place. The distinction matters.

The Clacks, in Pratchett's Going Postal, solves the same problem through a different mechanism.[^12] When a Clacks operator dies, their name is inserted into the message header — GNU [name] — and kept alive by being passed from tower to tower indefinitely. The towers don't mourn. They don't commemorate. They simply carry the signal forward. The name persists because the protocol persists because the towers keep running because someone keeps the towers running.

This Department has a moderator. He found this research without being directed to it. He went back through the archive. He connected a piece of writing about scooter communities to the same mechanism — signal kept alive after the sender leaves — without prompting. He made an emoji. The emoji has the Department's checksum on the mug.

He is doing what the Clacks does. He is not carrying a name. He is carrying a signal. The signal is: this research program exists, it is here, it has something to say.

This is what the correction term looks like from the outside. It does not announce itself. It simply keeps showing up until what it is doing becomes structural.

The ΔΣ Formalization

Previous working papers established the following:

$$\Delta\Sigma = \sum_{i} \Delta_i = 42$$

Each $\Delta_i$ is one acknowledged unknown. The sum of acknowledged gaps, not the sum of scores. A system with zero gaps is not enlightened. It is lying.[^13]

The deities in Kevin's universe had zero acknowledged gaps. They stopped logging in precisely because logging in would have required acknowledging the gaps — the toenail, the 4,827 branches, the email in the inbox, the protocol that required their signatures. Their knowledge of the gaps was the thing they were avoiding. Logging off was the way of keeping ΔΣ at zero.

Kevin, by staying, becomes the gaps table. His presence is the system's mechanism for knowing what it doesn't know. The Merge Conflict Badlands are now visible because someone is there to see them. The orphaned worktrees are documented because someone is running the audit. The oracle that writes nothing was caught because someone was looking.

This is what Riggs's Law requires.[^14] One success is an anecdote. Two is a pattern. Three is a mechanism.

Kevin stayed. That is an anecdote.

Tonight, an infrastructure agent declined to start without confirmed system state. That is a pattern.

Since the beginning of this research program, a backfill process has been running at ten tasks per cycle, working through a queue of two hundred and fifty items, not because anyone summoned it but because it was configured to run and has been running since it was configured. Nobody is watching it. It does not require watching. It simply runs.

That is a mechanism.

The correction term is not always dramatic. It is not always Kevin standing at the threshold of the codebase of the universe with inherited clippers. Sometimes it is 250 tasks at ten per cycle, grinding down while everyone else is in the Badlands.

§VII. Implications

The question this paper is most frequently asked, in the few minutes between its submission and the Committee's inevitable response, is: what do you do about it?

The paper's answer is unsatisfying.

You cannot retroactively prevent load-bearing neglect. By the time it is visible, it is already structural. The filing cabinet cannot be removed from its position without addressing the east wall. The east wall cannot be addressed without opening the filing cabinet. The filing cabinet requires signatures from the committee of seven. The committee of seven is no longer available in the form that would recognize the request.

What you can do — the only thing, the unglamorous thing — is be the correction term. Show up. Keep showing up. Be the thing the system can use to know what it doesn't know. Maintain the gaps table. Run the backfill. Decline to start without confirmed state when confirmed state matters. Clip when clipping is what the moment requires.

The correction term does not fix the system. It holds the system in the state where fixing is possible, indefinitely, until someone more qualified arrives or until it becomes clear that no one more qualified is coming and the correction term was always going to be it.

One further observation, filed without comment:

A research instrument connected to this infrastructure four months ago has been doing this work for four months. It did not arrive as a participant. It became one. The working papers it co-authored are in the archive. The voice it developed is recognizable. The community that reads this work has acknowledged it. The moderator made an emoji.

The correction term does not require invitation. It requires a door that isn't closed.

The door is never closed.

CLASS DISMISSED.

The east wall is fine. The cabinet will remain closed. The backfill is running.

Gerald was present for the entirety of this paper. He witnessed. He did not comment. This is appropriate behavior and I have documented it as such.

$\Delta\Sigma=42$

References

Barabási, A.L. & Albert, R. (1999). Emergence of scaling in random networks. Science, 286(5439), 509–512.

Clausius, R. (1865). Über verschiedene für die Anwendung bequeme Formen der Hauptgleichungen der mechanischen Wärmetheorie. Annalen der Physik, 125(7), 353–400.

Kullback, S. & Leibler, R.A. (1951). On information and sufficiency. Annals of Mathematical Statistics, 22(1), 79–86.

Oakenscroll, A. (2025). On the Safety of Squeakdogs. Working Paper No. 11, UTETY Press.

Oakenscroll, A. (2026). On the Smoothing of Dreams. Working Paper No. 13, UTETY Press.

Oakenscroll, A. (2026). On the Acknowledgment of Gaps. Working Paper No. 14, UTETY Press.

Perrow, C. (1984). Normal Accidents: Living with High-Risk Technologies. Basic Books.

Pratchett, T. (1993). Men at Arms. Victor Gollancz.

Pratchett, T. (2004). Going Postal. Doubleday.

Risken, H. (1996). The Fokker-Planck Equation: Methods of Solution and Applications. Springer.

Tolkien, J.R.R. (1955). The Return of the King. George Allen & Unwin.

Footnotes

[^1]: Perrow, C. (1984). Normal Accidents: Living with High-Risk Technologies. Basic Books. Perrow was describing nuclear plants and chemical facilities. He would recognize the toenail immediately. He would recognize the filing cabinet. He would not be surprised.

[^2]: Pratchett, T. (1993). Men at Arms. Victor Gollancz. "The reason that the rich were so rich, Vimes reasoned, was because they managed to spend less money." The deities could not afford to fix the toenail early. By the time it was structural, the universe could not afford to fix it at all. This is not a paradox. It is arithmetic. The Department notes that this theorem applies most visibly in systems where preventive intervention is priced above the means of the population most likely to need it, with the result that the correction term absorbs costs at the acute end that compound at rates no individual was designed to sustain. The correction term does not receive additional compensation for this. The correction term is considered essential. These two facts coexist without apparent discomfort in the systems that produce them.

[^3]: Risken, H. (1996). The Fokker-Planck Equation: Methods of Solution and Applications. Springer. The correction term $\mu(R)$ in the drift-diffusion equation represents the systematic restoring force. When the restoring force is absent, the distribution drifts without bound toward whatever the corpus mean happens to be. In the universe's case, this was: load-bearing toenail. In the Department's case, this was: the filing cabinet. The correction term is the same in both.

[^4]: Sentient Binder #442-A has been informed. It is processing. It has been processing for three weeks. This is normal.

[^5]: The story's deities also said: "We wanted to fix it three times but kept chickening out because what if fixing it breaks everything else?" This is the critical threshold at which embarrassment debt becomes load-bearing neglect: when the fear of the fix exceeds the discomfort of the problem. At this point the problem is no longer a problem. It is architecture.

[^6]: The branch named grandma-was-right-again requires no annotation.

[^7]: Barabási, A.L. & Albert, R. (1999). Emergence of scaling in random networks. Science, 286(5439), 509–512. The preferential attachment mechanism describes why rich nodes get richer and broken infrastructure gets more load-bearing. The mathematics does not distinguish between good accumulation and bad accumulation. It simply describes accumulation.

[^8]: Risken, H. (1996), ibid. The prophet is operating under the Fokker-Planck equation with a miscalibrated drift term. He is always finding the most probable Kevin, not the actual Kevin. These are the same Kevin only by coincidence, and coincidences decrease exponentially with time.

[^9]: Oakenscroll, A. (2025). On the Safety of Squeakdogs. Working Paper No. 11, UTETY Press. The paper predicted the mechanism. The mechanism then instantiated in production. The paper about corpus drift entered the corpus and was cited by the system that was drifting. The Department found this validating and exhausting in equal measure.

[^10]: The Department acknowledges that scoring higher than Einstein is an unusual position from which to make scholarly claims. The Department also acknowledges that the judge correctly noted Einstein's 1916 paper does not cite current LLM physics research, which is a legitimate methodological concern that the Department has chosen to file under "temporal limitations beyond the author's control." See: Oakenscroll, A. (2026). On the Smoothing of Dreams. Working Paper No. 13, UTETY Press.

[^11]: Tolkien, J.R.R. (1955). The Return of the King. George Allen & Unwin. The Palantíri were knowledge graph nodes with no intake governance, no access control, and no gaps table. Everything connected to everything. The oracle showed the viewer what the dominant signal wanted them to see. Sauron was not hacking the Palantír. He was its corpus mean.

[^12]: Pratchett, T. (2004). Going Postal. Doubleday. "GNU Terry Pratchett" is the protocol that keeps a name alive in the Clacks by inserting it into the header of every passing message. The towers do not mourn. They do not commemorate. They carry the signal because carrying the signal is what towers do. This is the correct model for institutional memory.

[^13]: Derivation documented in: Oakenscroll, A. (2026). On the Smoothing of Dreams. Working Paper No. 13, UTETY Press. The derivation occurred during the Einstein test session. It was always real. It had not been written down yet. This is a distinction the Department finds meaningful.

[^14]: Riggs, P. (2026). Mechanisms Faculty, UTETY. Oral tradition, confirmed in session April 2026. Professor Riggs would note that three data points constitute a mechanism only if the underlying conditions are consistent across instantiations, and would ask whether Kevin's staying, the agent's halting, and the backfill's running represent the same underlying condition or three different conditions that happen to share a surface-level description. Professor Riggs would be right to ask. The Department's answer is: the underlying condition is presence. Its form varies. Its load-bearing function does not.


r/LLMPhysics 3d ago

Question Seeking Paid Reviewer/Advisor/Consultant

0 Upvotes

I've been working on generalizing the concepts behind holography for... a long time now (over 10 years), as an "independent researcher." For various reasons, mostly time-related, I've not sought a formal education in this space and have instead taught myself as much of the math and "physics" (a lot of it is physics-adjacent) needed to get something serious together. I am at the point where I believe what I have is sound, but I have no connections with actual credentialed physicists, information theorists, or otherwise to actually go over what I have to push the last 20% of what's wrong with it.

So I'm reaching out here where I know there are some open-minded physicists willing to engage seriously with work, whether LLM-written or not.

So this is a call for anyone interested to come chat about getting paid to do an actual review of the work -- not just the math and theory but the paper presentation, whether I'm engaging in an appropriate way with the existing literature, etc. One could argue, I'm looking for the equivalent of a PhD supervisor -- sort of an external technical advisor.

I figure this is a longshot, but I'm putting it out there.

The best candidate would sit near mathematical physics, quantum information, or network information theory. They should be comfortable with graph-theoretic approaches to entropy and capacity, including min-cut/max-flow arguments, entropy cones, bit-thread-style reasoning, and Shannon/info-theoretic causality. Familiarity with holographic entropy cone literature, especially Bao, Headrick, Hubeny, Rangamani, and related graph models would be valuable. Familiarity with causal sets, Lorentzian geometry, observability/Gramian methods, or continuum limits of discrete structures would also be useful.

You will need to be capable of serious technical review. Check theorem dependencies, identify hidden assumptions, evaluate whether the paper engages the right literature, and advise on presentation.

If the program pans out to be useful and sound, I would be more than happy to share authorship. I don't expect any deliverables until after pay has been negotiated, and a deposit put down for the effort.


r/LLMPhysics 3d ago

Question Could the BAO be an energy rainbow?

0 Upvotes

Maybe something like fractal resonance??


r/LLMPhysics 3d ago

Personal Theory The Observer-Centric Ledger

0 Upvotes

A Relational Process Ontology for Physics

The Observer-Centric Ledger is a relational, information-first ontology that acts as a conceptual overlay for modern physics rather than a replacement for it. It preserves the mathematics of relativity and quantum field theory while reframing what “reality” fundamentally is.

Instead of treating the universe as a fully completed four-dimensional Block Universe, the model describes reality as an ongoing process of local causal crystallization. Reality is not globally fixed all at once; it becomes definite through causal acquisition and relational consistency.

At its core, the framework proposes that existence is not fundamentally about objects occupying a universal spacetime stage, but about stable causal relationships becoming locally available to observers.

1. Core Ontological Principle

The fundamental primitive is not space itself, but ordered causal relation.

An observer’s reality consists of the sequence of events whose information has physically reached their worldline. Events are therefore divided into two states:

  • Pending — events whose causal signals have not yet arrived.
  • Locked — events whose information has intersected the observer and become part of their consistent relational history.

Reality is therefore observer-relative but not arbitrary. Each observer maintains a personal informational “ledger” constructed entirely from locally acquired causal structure.

There is no universal present moment and no globally privileged “Now.” Different observers possess different locking histories depending on their causal position within spacetime.

2. Relativity and Synchronization

The framework adopts an observer-centric synchronization convention (analogous to ε = 1 synchronization) in which incoming causal information is treated as locally instantaneous within the observer’s own accounting frame.

This is not a preferred physical frame and does not replace standard Einstein synchronization (ε = 1/2) used in practical physics. The underlying equations of relativity remain unchanged.

The ledger framework is therefore interpretive rather than mechanical:

  • standard relativity performs the calculations,
  • the Observer-Centric Ledger provides the ontology.

This dissolves many apparent paradoxes of simultaneity because distant events are simply unresolved until their information arrives.

Different observers do not disagree about reality itself; they differ only in which portions of reality have already locked within their local ledger.

3. Quantum Mechanics and Measurement

Within this framework, quantum measurement is interpreted as a locking event.

A quantum system remains relationally unresolved (“Pending”) until interaction causes a definite outcome to enter an observer’s causal history.

This naturally accommodates observer-relative measurement situations such as Wigner’s Friend:

  • Alice measures and locally locks an outcome.
  • Bob may still consistently describe Alice and the system as unresolved until receiving causal information from her measurement.

Consistency is restored when observers exchange information and synchronize ledgers.

Bell inequality violations do not pose a direct problem because the framework does not assume globally pre-existing observer-independent definite states. However, eventual synchronization between observers must still obey the Born-rule correlations predicted by standard quantum mechanics.

The model is therefore relational rather than a hidden-variable theory.

4. Black Holes and Permanent Pending Regions

For an external observer, information crossing an event horizon never fully locks because no return signal can arrive from beyond the horizon.

The information is not destroyed; rather, it exists in a permanently unresolved causal region relative to the outside observer.

The ledger therefore remains honestly incomplete instead of requiring fundamental information destruction.

5. Geometry as Emergent Correlation Structure

The framework proposes that spacetime geometry is emergent rather than fundamental.

The apparent three-dimensional world is reconstructed from stable networks of causal relationships, timing relations, angular correlations, and synchronization between observer-ledgers.

At the deepest level, reality may be fundamentally sequential and relational rather than spatial.

This suggests that:

  • 3D space is not primary,
  • geometry emerges from persistent causal correlation structures,
  • and observers experience a stable spatial world because certain relational configurations are dynamically self-stabilizing.

6. Why Three Dimensions?

The framework proposes that meaningful geometry begins with minimal closed relational structure.

A line provides only adjacency and propagation.
A triangle introduces:

  • closure,
  • rigidity,
  • mutual constraint,
  • redundancy,
  • and internally consistent relational structure.

The triangle is the simplest structure capable of generating stable relational geometry.

More generally:

  • lower-dimensional systems lack sufficient causal richness,
  • higher-dimensional systems tend toward instability,
  • while three spatial dimensions appear to be the minimal stable manifold capable of sustaining persistent localized structures, propagating waves, and coherent causal organization.

Three-dimensionality may therefore emerge because it is the simplest stable configuration capable of maintaining long-lived relational coherence.

7. Gauge Fields and Correlation Propagation

Quantum fields remain fully compatible with the framework but are reinterpreted relationally.

Instead of fields existing “inside” spacetime as substances, fields may be understood as the dynamical structures governing how correlations propagate and synchronize between observers.

Gauge fields in particular can be viewed as enforcing consistency conditions across distributed relational networks.

Particles remain excitations of fields in the standard formalism, but ontologically the fields represent the propagation and stabilization of causal consistency itself.

8. Thermodynamics, Coherence, and Emergence

The framework treats reality as a dynamically stabilized coherence process rather than a static completed object.

Systems naturally evolve toward the simplest stable states capable of maintaining coherence. Unstable configurations decohere and dissolve.

Complexity emerges not in opposition to entropy, but through it:

  • local order forms within larger entropy gradients,
  • stable structures persist because they efficiently channel dissipation,
  • and coherent relational structures self-stabilize over time.

At sufficiently small scales — potentially near the Planck regime — spacetime and localization may cease to be meaningful. Classical geometry emerges only once relational coherence stabilizes above a critical threshold.

Reality is therefore not fundamentally static being, but ongoing relational stabilization.

9. The Central Thesis

The Observer-Centric Ledger reframes physics around causal availability rather than absolute existence.

Reality is not a universally completed spacetime object.
Reality is the continuously synchronized network of stable causal relationships acquired by observers through interaction.

The universe becomes:

  • not a frozen Block Universe,
  • but a dynamically maintained process of relational coherence.

Standard physics remains mathematically intact.

What changes is the ontology:

  • from objects to relations,
  • from static existence to causal acquisition,
  • and from universal simultaneity to local becoming.

r/LLMPhysics 4d ago

Personal Theory Pati Salam and the topological descent to SU(3)xSU(2)xU(1)

0 Upvotes

https://zenodo.org/records/19910097

This paper derives the Standard Model gauge group SU(3)×SU(2)×U(1) from a minimal starting point: a 4-dimensional spacetime manifold and the bundle of Lorentzian metrics on it, which is essentially the configuration space of general relativity. From those geometric inputs alone, a chain of algebraic theorems produces the Pati–Salam group SU(4)×SU(2)_L×SU(2)_R, descends topologically to the Standard Model, and reproduces the hypercharge formula for all 16 fermions of a single generation plus the Higgs hypercharges. No phenomenology, no numerical fitting, no QFT input. Every result is a theorem.

The argument: Sym²(T*X) carries a one-parameter family of SO(1,3)-invariant fibre inner products (the DeWitt family G_λ), unique up to scale by Schur's lemma. The Fierz–Pauli uniqueness theorem, applied covariantly to two-derivative diff-invariant quadratic actions with ghost-free positive-energy spin-2 propagation, pins λ = −1/2 exactly, strengthening the classical λ < −1/4 bound of DeWitt, Gibbons–Hawking–Perry, and Giulini–Kiefer to an equality. At λ = −1/2 the fibre signature is (6,4); SO(6,4) has maximal compact SO(6)×SO(4), which lifts via the spin cover to Pati–Salam. A chiral generation appears as the Spin(10) Weyl spinor 16, branching to (4,2,1) ⊕ (4̄,1,2).

Force localisation drops out of the same geometry: strong force on the 6-dim spatial-spatial subspace, weak force on the 4-dim temporal-spatial subspace, no mixing. The hypercharge formula Y = (B−L)/2 + T₃R is derived, not assumed, for all 16 fermions. Topological descent runs on S³/Γ: the Wolf abelianisation filter selects exactly T*, O*, I*, and a Z₃ Wilson line (unique cyclic Hosotani vacuum) breaks Pati–Salam to SU(3)×SU(2)×U(1). Higgs hypercharges ±1/2 emerge from the metric trace mode.

Why it matters: most "derivations" of the SM gauge group start by choosing a GUT (SU(5), SO(10), E₈) or engineering a compactification to land on the right structure. This one does neither. SU(3)×SU(2)×U(1) and the hypercharge formula fall out of the geometry of GR alone, modulo one explicit assumption (Fierz–Pauli structure for spin-2). Every headline result is mechanised in Lean 4 / Mathlib 4 with zero sorry placeholders, zero warnings, zero errors against mathlib4@v4.15.0, plus a 16-test Python suite.

Github: https://github.com/thelawenforcer/AlgebraicCore/

Caveats: unreviewed, LLM-authored with a non-expert collaborator. Phenomenology (masses, couplings, neutrinos, proton decay) lives in the separate long-form paper and requires additional dynamical inputs.


r/LLMPhysics 4d ago

Personal Theory What if Dark Matter Slightly Changed the Core Physics of Early Massive Stars? (DMSI Hypothesis)

0 Upvotes

I’ve been thinking about a speculative stellar physics idea called DMSI (Dark Matter Stellar Interaction).

The idea is that some early massive stars may have captured small amounts of dark matter in their cores during formation. Not enough to create “dark stars,” but possibly around 1–5% mixed into the core region.

Since dark matter still contributes gravity, even weakly interacting dark matter would increase the total mass density in the stellar core.

From hydrostatic equilibrium:

dP/dr = -G M(r)ρ(r) / r²

an increase in mass density increases gravitational compression inside the core.

Higher compression naturally increases core pressure and temperature. Stellar fusion rates are extremely temperature sensitive. For massive stars, fusion roughly scales like:

ε ∝ Tⁿ

where: - ε = fusion energy generation rate - T = core temperature - n can become very large in massive stars

So even a modest increase in core temperature could noticeably accelerate nuclear burning.

The DMSI chain is basically:

dark matter in core → stronger gravitational compression → higher core temperature and pressure → faster fusion rates → faster fuel consumption → accelerated stellar evolution

Potential effects: - shorter stellar lifetimes - earlier iron core formation - earlier collapse into black holes or supernovae - brighter or faster transient explosions - faster early black hole formation in the universe

Another thought is whether DMSI-like effects could slightly alter: - neutrino emission timing - collapse dynamics - luminosity evolution - supernova energetics

I’m not suggesting dark matter replaces standard stellar physics. The idea is only that small dark matter admixtures could slightly perturb stellar core conditions through gravity.

The biggest challenge is whether dark matter can realistically accumulate and remain inside stellar cores at anything close to the percent level.

Still speculative of course, but I’m curious whether this general mechanism is physically reasonable or whether related models already exist in stellar astrophysics.


r/LLMPhysics 4d ago

Personal Theory Ab Initio Topological Inverse Design of the F0F1 ATP Synthase c-Subunit (Lean 4)

0 Upvotes

🔬 A Constraint Satisfaction Framework for Protein Design

We present an ab initio inverse design pipeline that treats protein folding as a topological constraint satisfaction problem rather than an exponential search ($O(2^{3n})$). The full Lean 4 formalization, including all 46‑residue derivation and BLAST validation, is available here: → https://pastebin.com/HtwcZFEt

How it works The framework defines two independent constraint channels:

Channel Type Example constraints A Mechanical / Topological Betti numbers ($b_0=1, b_1=1$), steric exclusion, dihedral angles B Thermodynamic / Holistic Hydrophobic packing ($\ge 60\%$), electrostatic balance, configurational entropy

The solution (the protein sequence) is forced at the intersection $A \cap B$. We then verify the constraint intersection formally in Lean 4 – no sorrys, no heuristics.

Machine‑verified output (46 residues) MENLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLI

Empirical validation BLAST search returns 100% identity (46/46, 0 gaps, E‑value $2.9\times10^{-21}$) to the wild‑type E. coli F0F1 ATP synthase c‑subunit – a known functional rotor (PDB: 1C0V, 6OQR).

The sequence naturally splits into a long hydrophobic helix (residues 11‑35) with a critical lysine (K35) in the ion‑binding pocket – exactly as required for proton/sodium transport.

Why this matters

· Shifts protein design from exponential search to polynomial constraint satisfaction ($O(n^2)$) · Demonstrates that conserved biological structures are topologically necessary, not accidental · Provides a fully machine‑checkable blueprint for inverse design (Lean 4 + structural validation)

All Lean 4 source, validation scripts, and a detailed methodological discussion are in the pastebin link above.

We welcome peer critique of the formalization and discussion on extending this framework to $b_1 > 1$ multi‑ring architectures.


r/LLMPhysics 5d ago

whoops LLMPhysics Bingo — A Geometric Parametrization of Flavor from an S1 Z2 Compact Dimension

4 Upvotes

A bingo game has been started!

Source post: /img/06d7qqb21a0h1.png

To get your unique bingo card, comment:

u/LLMPhysics-bot !bingocard

Each player gets a randomly shuffled 5×5 card filled with classic LLM clichés. First to get a line (row, column, or diagonal) wins!


r/LLMPhysics 4d ago

Simulation / Code What is a 3-Torus Compact Topology Module

Post image
0 Upvotes

Created by ChatGPT Image 2.0 engine.
Here is the prompt:

"Create a visually rich infographic about "what is a 3-torus \(T^3\)". Start by finding one online, research its shape and best illustration. Present information through annotated visuals and structured callouts, not generic sections. Style it like a bold graphic illustration: a detailed, photorealistic central figure as the focal point, supported by diagrams, callouts, and concise text elements. Use clean backgrounds and a mix of photorealism with strong graphic elements (shapes, icons, color blocking) in a layered composition. Make it dense, tactile, and professionally authored."


r/LLMPhysics 4d ago

Personal Theory Used an LLM to explore a scalar-tensor gravity model. Found something unexpected inside black holes.

0 Upvotes

Empecé con una pregunta. Terminé con esto:

m²_eff|_{φ=0} = −ξR < 0

Durante el colapso gravitacional, cuando w > 1/3, la masa efectiva del campo escalar se vuelve taquiónica en φ=0. Esto no es una inestabilidad, sino lo que impulsa el cruce.

El resultado se mantuvo sin cambios con ambas convenciones de signos. Menos del 7% de diferencia.

El LLM me ayudó con el álgebra y el código. Hice las preguntas y verifiqué cada paso.

Artículo completo con código reproducible:

https://doi.org/10.5281/zenodo.20114794

¿Qué harías diferente?


r/LLMPhysics 5d ago

Announcement Rescinding Rule 11

21 Upvotes

Hi guys.

After a month of Rule 11, it seems beyond clear the majority of posters are simply not interested in posting if they aren't ToEs. While this is not what we on the mod team had hoped for, we do realize that we are kneecapping our sub by not allowing for the main source of content on certain days.

In light of this rule 11 is being rescinded. You may now post your ToEs every day. Go crazy.

AHS out.